SCOPe 2.03: Domain d1fmms_: 1fmm S:

Lineage for d1fmms_ (1fmm S:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Eastern newt (Notophthalmus viridescens) [TaxId:8316] [63778] (1 PDB entry)

8. Domain d1fmms_: 1fmm S: [59883]

Details for d1fmms_

PDB Entry: 1fmm

PDB Description: solution structure of nfgf-1

PDB Compounds: (S:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1fmms_:

Sequence; same for both SEQRES and ATOM records:

>d1fmms_ b.42.1.1 (S:) Acidic FGF (FGF1) {Eastern newt (Notophthalmus viridescens) [TaxId: 8316]}
qkpkllycsnggyflrifpdgkvdgtrdrsdpyiqlqfyaesvgevyiksletgqylamd
sdgqlyasqspseeclflerleennyntykskvhadkdwfvgikkngktkpgsrthfgqk
ailflplpvssd

Timeline for d1fmms_:

• d1fmms_ first appeared in SCOP 1.57
  
• d1fmms_ appears in SCOPe 2.02
  
• d1fmms_ appears in SCOPe 2.04
  
• d1fmms_ appears in the current release, SCOPe 2.08