Lineage for d1fmms_ (1fmm S:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375318Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 375319Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 375320Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 375332Species Eastern newt (Notophthalmus viridescens) [TaxId:8316] [63778] (1 PDB entry)
  8. 375333Domain d1fmms_: 1fmm S: [59883]

Details for d1fmms_

PDB Entry: 1fmm (more details)

PDB Description: solution structure of nfgf-1

SCOP Domain Sequences for d1fmms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmms_ b.42.1.1 (S:) Acidic FGF (FGF1) {Eastern newt (Notophthalmus viridescens)}
qkpkllycsnggyflrifpdgkvdgtrdrsdpyiqlqfyaesvgevyiksletgqylamd
sdgqlyasqspseeclflerleennyntykskvhadkdwfvgikkngktkpgsrthfgqk
ailflplpvssd

SCOP Domain Coordinates for d1fmms_:

Click to download the PDB-style file with coordinates for d1fmms_.
(The format of our PDB-style files is described here.)

Timeline for d1fmms_: