Class b: All beta proteins [48724] (141 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (2 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) |
Protein Acidic FGF (FGF1) [50357] (3 species) |
Species Eastern newt (Notophthalmus viridescens) [TaxId:8316] [63778] (1 PDB entry) |
Domain d1fmms_: 1fmm S: [59883] |
PDB Entry: 1fmm (more details)
SCOP Domain Sequences for d1fmms_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmms_ b.42.1.1 (S:) Acidic FGF (FGF1) {Eastern newt (Notophthalmus viridescens)} qkpkllycsnggyflrifpdgkvdgtrdrsdpyiqlqfyaesvgevyiksletgqylamd sdgqlyasqspseeclflerleennyntykskvhadkdwfvgikkngktkpgsrthfgqk ailflplpvssd
Timeline for d1fmms_: