SCOP 1.59: Domain d1fl7c_: 1fl7 C:

Lineage for d1fl7c_ (1fl7 C:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)

6. Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63397] (6 PDB entries)

8. Domain d1fl7c_: 1fl7 C: [59873]
   Other proteins in same PDB: d1fl7b_, d1fl7d_

Details for d1fl7c_

PDB Entry: 1fl7, 3 Å

PDB Description: human follicle stimulating hormone

SCOP Domain Sequences for d1fl7c_:

Sequence; same for both SEQRES and ATOM records:

>d1fl7c_ g.17.1.4 (C:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens)}
qdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaks
ynrvtvmggfkvenhtachcstcyyhks

Timeline for d1fl7c_:

• d1fl7c_ first appeared in SCOP 1.57
  
• d1fl7c_ appears in SCOP 1.61
  
• d1fl7c_ appears in the current release, SCOPe 2.08