SCOP 1.69: Domain d1fl2a2: 1fl2 A:326-451

Lineage for d1fl2a2 (1fl2 A:326-451)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (13 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (2 species)

7. Species Escherichia coli [TaxId:562] [63949] (1 PDB entry)

8. Domain d1fl2a2: 1fl2 A:326-451 [59870]
   Catalytic core component only

Details for d1fl2a2

PDB Entry: 1fl2, 1.9 Å

PDB Description: catalytic core component of the alkylhydroperoxide reductase ahpf from e.coli

SCOP Domain Sequences for d1fl2a2:

Sequence; same for both SEQRES and ATOM records:

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli}
wrnmnvpgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtlle
fapemkadqvlqdklrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihnielagi
fvqigl

Timeline for d1fl2a2:

• d1fl2a2 first appeared in SCOP 1.57
  
• d1fl2a2 appears in SCOP 1.67
  
• d1fl2a2 appears in SCOP 1.71
  
• d1fl2a2 appears in the current release, SCOPe 2.08