Lineage for d1fl2a2 (1fl2 A:326-451)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) 
Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (2 species) Species Escherichia coli [TaxId:562] [63949] (1 PDB entry) 
Domain d1fl2a2: 1fl2 A:326-451 [59870]
Details for d1fl2a2
PDB Entry: 1fl2 (more details), 1.9 Å
PDB Description: catalytic core component of the alkylhydroperoxide reductase ahpf from e.coli
SCOP Domain Sequences for d1fl2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli}
wrnmnvpgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtlle
fapemkadqvlqdklrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihnielagi
fvqigl
SCOP Domain Coordinates for d1fl2a2:
Click to download the PDB-style file with coordinates for d1fl2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fl2a2:
- d1fl2a2 first appeared in SCOP 1.57
- d1fl2a2 appears in SCOP 1.61
- d1fl2a2 appears in the current release, SCOPe 2.08
View in 3D
