Lineage for d1fl2a2 (1fl2 A:326-451)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119206Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 119207Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (2 species)
  7. 119208Species Escherichia coli [TaxId:562] [63949] (1 PDB entry)
  8. 119210Domain d1fl2a2: 1fl2 A:326-451 [59870]

Details for d1fl2a2

PDB Entry: 1fl2 (more details), 1.9 Å

PDB Description: catalytic core component of the alkylhydroperoxide reductase ahpf from e.coli

SCOP Domain Sequences for d1fl2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli}
wrnmnvpgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtlle
fapemkadqvlqdklrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihnielagi
fvqigl

SCOP Domain Coordinates for d1fl2a2:

Click to download the PDB-style file with coordinates for d1fl2a2.
(The format of our PDB-style files is described here.)

Timeline for d1fl2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fl2a1