Lineage for d1fk6a_ (1fk6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998158Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 1998159Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 1998160Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 protein domains)
  6. 1998168Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 1998178Species Maize (Zea mays) [TaxId:4577] [47706] (11 PDB entries)
  8. 1998188Domain d1fk6a_: 1fk6 A: [59867]
    complexed with fmt, lnl

Details for d1fk6a_

PDB Entry: 1fk6 (more details), 1.9 Å

PDB Description: structural basis of non-specific lipid binding in maize lipid-transfer protein complexes with alpha-linolenic acid revealed by high- resolution x-ray crystallography
PDB Compounds: (A:) non-specific lipid transfer protein

SCOPe Domain Sequences for d1fk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fk6a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]}
aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
sglnagnaasipskcgvsipytiststdcsrvn

SCOPe Domain Coordinates for d1fk6a_:

Click to download the PDB-style file with coordinates for d1fk6a_.
(The format of our PDB-style files is described here.)

Timeline for d1fk6a_: