Lineage for d1fjrb_ (1fjr B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679232Fold b.102: Methuselah ectodomain [63876] (1 superfamily)
    complex fold
  4. 679233Superfamily b.102.1: Methuselah ectodomain [63877] (1 family) (S)
    duplication: contains two similar sub domains connected by a structured linker
  5. 679234Family b.102.1.1: Methuselah ectodomain [63878] (1 protein)
  6. 679235Protein Methuselah ectodomain [63879] (1 species)
  7. 679236Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63880] (1 PDB entry)
  8. 679238Domain d1fjrb_: 1fjr B: [59856]
    complexed with nag, pb, so4

Details for d1fjrb_

PDB Entry: 1fjr (more details), 2.3 Å

PDB Description: crystal structure of the ectodomain of methuselah
PDB Compounds: (B:) methuselah ectodomain

SCOP Domain Sequences for d1fjrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjrb_ b.102.1.1 (B:) Methuselah ectodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
aphncliv

SCOP Domain Coordinates for d1fjrb_:

Click to download the PDB-style file with coordinates for d1fjrb_.
(The format of our PDB-style files is described here.)

Timeline for d1fjrb_: