Lineage for d1fjja_ (1fjj A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370218Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 370219Superfamily b.17.1: PEBP-like [49777] (2 families) (S)
  5. 370237Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins)
  6. 370242Protein Hypothetical protein YbhB [63702] (1 species)
  7. 370243Species Escherichia coli [TaxId:562] [63703] (2 PDB entries)
  8. 370244Domain d1fjja_: 1fjj A: [59852]
    complexed with epe

Details for d1fjja_

PDB Entry: 1fjj (more details), 1.66 Å

PDB Description: crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family

SCOP Domain Sequences for d1fjja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjja_ b.17.1.2 (A:) Hypothetical protein YbhB {Escherichia coli}
amklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgs
gwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryift
vhaldieridvdegasgamvgfnvhfhslasasitamfs

SCOP Domain Coordinates for d1fjja_:

Click to download the PDB-style file with coordinates for d1fjja_.
(The format of our PDB-style files is described here.)

Timeline for d1fjja_: