SCOP 1.67: Domain d1fjja_: 1fjj A:

Lineage for d1fjja_ (1fjj A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (2 families)

5. Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins)

6. Protein Hypothetical protein YbhB [63702] (1 species)

7. Species Escherichia coli [TaxId:562] [63703] (2 PDB entries)

8. Domain d1fjja_: 1fjj A: [59852]
   complexed with epe

Details for d1fjja_

PDB Entry: 1fjj, 1.66 Å

PDB Description: crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family

SCOP Domain Sequences for d1fjja_:

Sequence; same for both SEQRES and ATOM records:

>d1fjja_ b.17.1.2 (A:) Hypothetical protein YbhB {Escherichia coli}
amklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgs
gwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryift
vhaldieridvdegasgamvgfnvhfhslasasitamfs

Timeline for d1fjja_:

• d1fjja_ first appeared in SCOP 1.57
  
• d1fjja_ appears in SCOP 1.65
  
• d1fjja_ appears in SCOP 1.69
  
• d1fjja_ appears in the current release, SCOPe 2.08, called d1fjja1