SCOP 1.67: Domain d1fi4a2: 1fi4 A:191-393

Lineage for d1fi4a2 (1fi4 A:191-393)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.2: Mevalonate 5-diphosphate decarboxylase [64281] (1 protein)

6. Protein Mevalonate 5-diphosphate decarboxylase [64282] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64283] (1 PDB entry)

8. Domain d1fi4a2: 1fi4 A:191-393 [59848]
   Other proteins in same PDB: d1fi4a1
   mutant

Details for d1fi4a2

PDB Entry: 1fi4, 2.27 Å

PDB Description: the x-ray crystal structure of mevalonate 5-diphosphate decarboxylase at 2.3 angstrom resolution.

SCOP Domain Sequences for d1fi4a2:

Sequence; same for both SEQRES and ATOM records:

>d1fi4a2 d.58.26.2 (A:191-393) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)}
qmkacvlvvsdikkdvsstqgmqltvatselfkeriehvvpkrfevmrkaivekdfatfa
ketmmdsnsfhatcldsfppifymndtskriiswchtinqfygetivaytfdagpnavly
ylaenesklfafiyklfgsvpgwdkkftteqleafnhqfessnftareldlelqkdvarv
iltqvgsgpqetneslidaktgl

Timeline for d1fi4a2:

• d1fi4a2 first appeared in SCOP 1.57
  
• d1fi4a2 appears in SCOP 1.65
  
• d1fi4a2 appears in SCOP 1.69
  
• d1fi4a2 appears in the current release, SCOPe 2.08