Lineage for d1fi4a2 (1fi4 A:191-393)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.26: GHMP Kinase [55060] (2 families) 
Family d.58.26.2: Mevalonate 5-diphosphate decarboxylase [64281] (1 protein) Protein Mevalonate 5-diphosphate decarboxylase [64282] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64283] (1 PDB entry) 
Domain d1fi4a2: 1fi4 A:191-393 [59848]
Other proteins in same PDB: d1fi4a1
Details for d1fi4a2
PDB Entry: 1fi4 (more details), 2.27 Å
PDB Description: the x-ray crystal structure of mevalonate 5-diphosphate decarboxylase at 2.3 angstrom resolution.
SCOP Domain Sequences for d1fi4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fi4a2 d.58.26.2 (A:191-393) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)}
qmkacvlvvsdikkdvsstqgmqltvatselfkeriehvvpkrfevmrkaivekdfatfa
ketmmdsnsfhatcldsfppifymndtskriiswchtinqfygetivaytfdagpnavly
ylaenesklfafiyklfgsvpgwdkkftteqleafnhqfessnftareldlelqkdvarv
iltqvgsgpqetneslidaktgl
SCOP Domain Coordinates for d1fi4a2:
Click to download the PDB-style file with coordinates for d1fi4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fi4a2:
- d1fi4a2 is new in SCOP 1.57
- d1fi4a2 appears in SCOP 1.59
- d1fi4a2 appears in the current release, SCOPe 2.08
View in 3D
