Lineage for d1fi4a2 (1fi4 A:191-393)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954566Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954584Family d.58.26.2: Mevalonate 5-diphosphate decarboxylase [64281] (1 protein)
  6. 2954585Protein Mevalonate 5-diphosphate decarboxylase [64282] (1 species)
  7. 2954586Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64283] (1 PDB entry)
  8. 2954587Domain d1fi4a2: 1fi4 A:191-393 [59848]
    Other proteins in same PDB: d1fi4a1

Details for d1fi4a2

PDB Entry: 1fi4 (more details), 2.27 Å

PDB Description: the x-ray crystal structure of mevalonate 5-diphosphate decarboxylase at 2.3 angstrom resolution.
PDB Compounds: (A:) mevalonate 5-diphosphate decarboxylase

SCOPe Domain Sequences for d1fi4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi4a2 d.58.26.2 (A:191-393) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qmkacvlvvsdikkdvsstqgmqltvatselfkeriehvvpkrfevmrkaivekdfatfa
ketmmdsnsfhatcldsfppifymndtskriiswchtinqfygetivaytfdagpnavly
ylaenesklfafiyklfgsvpgwdkkftteqleafnhqfessnftareldlelqkdvarv
iltqvgsgpqetneslidaktgl

SCOPe Domain Coordinates for d1fi4a2:

Click to download the PDB-style file with coordinates for d1fi4a2.
(The format of our PDB-style files is described here.)

Timeline for d1fi4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fi4a1