Lineage for d1fi3a_ (1fi3 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719701Protein Cytochrome c551 [46660] (5 species)
  7. 1719730Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries)
  8. 1719732Domain d1fi3a_: 1fi3 A: [59846]
    complexed with hec; mutant

Details for d1fi3a_

PDB Entry: 1fi3 (more details)

PDB Description: solution structure of the m61h mutant of pseudomonas stutzeri substrain zobell ferrocytochrome c-551
PDB Compounds: (A:) cytochrome c-551

SCOPe Domain Sequences for d1fi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi3a_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri [TaxId: 316]}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
hppnpvteeeakilaewvlslk

SCOPe Domain Coordinates for d1fi3a_:

Click to download the PDB-style file with coordinates for d1fi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi3a_: