SCOPe 2.04: Domain d1fi3a_: 1fi3 A:

Lineage for d1fi3a_ (1fi3 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c551 [46660] (4 species)

7. Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries)

8. Domain d1fi3a_: 1fi3 A: [59846]
   complexed with hec; mutant

Details for d1fi3a_

PDB Entry: 1fi3

PDB Description: solution structure of the m61h mutant of pseudomonas stutzeri substrain zobell ferrocytochrome c-551

PDB Compounds: (A:) cytochrome c-551

SCOPe Domain Sequences for d1fi3a_:

Sequence; same for both SEQRES and ATOM records:

>d1fi3a_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri [TaxId: 316]}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
hppnpvteeeakilaewvlslk

Timeline for d1fi3a_:

• d1fi3a_ first appeared in SCOP 1.57
  
• d1fi3a_ appears in SCOPe 2.03
  
• d1fi3a_ appears in SCOPe 2.05
  
• d1fi3a_ appears in the current release, SCOPe 2.08