Lineage for d1fi3a_ (1fi3 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94591Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 94634Protein Cytochrome c551 [46660] (4 species)
  7. 94644Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries)
  8. 94647Domain d1fi3a_: 1fi3 A: [59846]

Details for d1fi3a_

PDB Entry: 1fi3 (more details)

PDB Description: solution structure of the m61h mutant of pseudomonas stutzeri substrain zobell ferrocytochrome c-551

SCOP Domain Sequences for d1fi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi3a_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
hppnpvteeeakilaewvlslk

SCOP Domain Coordinates for d1fi3a_:

Click to download the PDB-style file with coordinates for d1fi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi3a_: