SCOPe 2.05: Domain d1fi2a_: 1fi2 A:

Lineage for d1fi2a_ (1fi2 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein Germin [63853] (1 species)
   Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer

7. Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries)

8. Domain d1fi2a_: 1fi2 A: [59845]
   complexed with mn

Details for d1fi2a_

PDB Entry: 1fi2, 1.6 Å

PDB Description: crystal structure of germin (oxalate oxidase)

PDB Compounds: (A:) oxalate oxidase

SCOPe Domain Sequences for d1fi2a_:

Sequence; same for both SEQRES and ATOM records:

>d1fi2a_ b.82.1.2 (A:) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}
tdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs

Timeline for d1fi2a_:

• d1fi2a_ first appeared in SCOP 1.57
  
• d1fi2a_ appears in SCOPe 2.04
  
• d1fi2a_ appears in SCOPe 2.06
  
• d1fi2a_ appears in the current release, SCOPe 2.08