Lineage for d1fi1a_ (1fi1 A:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886206Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 886252Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 886337Family f.4.3.3: Ligand-gated protein channel [56948] (4 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 886341Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 886342Species Escherichia coli [TaxId:562] [56950] (10 PDB entries)
  8. 886348Domain d1fi1a_: 1fi1 A: [59844]
    complex with lipopolysaccharide
    complexed with ddq, dpo, ftt, gal, gcn, glc, gmh, kdo, mg, na, ni, po4, rif; mutant

Details for d1fi1a_

PDB Entry: 1fi1 (more details), 2.9 Å

PDB Description: fhua in complex with lipopolysaccharide and rifamycin cgp4832
PDB Compounds: (A:) Ferrichrome-iron receptor

SCOP Domain Sequences for d1fi1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi1a_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOP Domain Coordinates for d1fi1a_:

Click to download the PDB-style file with coordinates for d1fi1a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi1a_: