Lineage for d1fi1a_ (1fi1 A:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 88062Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies)
  4. 88084Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 88153Family f.4.3.3: Ligand-gated protein channel [56948] (2 proteins)
  6. 88157Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 88158Species Escherichia coli [TaxId:562] [56950] (9 PDB entries)
  8. 88165Domain d1fi1a_: 1fi1 A: [59844]

Details for d1fi1a_

PDB Entry: 1fi1 (more details), 2.9 Å

PDB Description: fhua in complex with lipopolysaccharide and rifamycin cgp4832

SCOP Domain Sequences for d1fi1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi1a_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOP Domain Coordinates for d1fi1a_:

Click to download the PDB-style file with coordinates for d1fi1a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi1a_: