Lineage for d1fhna_ (1fhn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2768959Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2768980Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
    Uniprot P02766 31-143
  8. 2769518Domain d1fhna_: 1fhn A: [59842]

Details for d1fhna_

PDB Entry: 1fhn (more details), 1.75 Å

PDB Description: transthyretin stability as a key factor in amyloidogenesis
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d1fhna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhna_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn

SCOPe Domain Coordinates for d1fhna_:

Click to download the PDB-style file with coordinates for d1fhna_.
(The format of our PDB-style files is described here.)

Timeline for d1fhna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fhnb_