Lineage for d1fhma_ (1fhm A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066161Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1066170Protein Rubredoxin [57804] (8 species)
  7. 1066171Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
    Uniprot P00268
  8. 1066193Domain d1fhma_: 1fhm A: [59841]
    complexed with fe2

Details for d1fhma_

PDB Entry: 1fhm (more details), 1.5 Å

PDB Description: x-ray crystal structure of reduced rubredoxin
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1fhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhma_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve

SCOPe Domain Coordinates for d1fhma_:

Click to download the PDB-style file with coordinates for d1fhma_.
(The format of our PDB-style files is described here.)

Timeline for d1fhma_: