Lineage for d1fhjd_ (1fhj D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 208567Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 208921Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 209163Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63441] (1 PDB entry)
  8. 209165Domain d1fhjd_: 1fhj D: [59840]
    Other proteins in same PDB: d1fhja_, d1fhjc_
    complexed with hem

Details for d1fhjd_

PDB Entry: 1fhj (more details), 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.

SCOP Domain Sequences for d1fhjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhjd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Maned wolf (Chrysocyon brachyurus)}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1fhjd_:

Click to download the PDB-style file with coordinates for d1fhjd_.
(The format of our PDB-style files is described here.)

Timeline for d1fhjd_: