Lineage for d1fhjc_ (1fhj C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 208567Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 208672Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 208907Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63440] (1 PDB entry)
  8. 208909Domain d1fhjc_: 1fhj C: [59839]
    Other proteins in same PDB: d1fhjb_, d1fhjd_
    complexed with hem

Details for d1fhjc_

PDB Entry: 1fhj (more details), 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.

SCOP Domain Sequences for d1fhjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhjc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Maned wolf (Chrysocyon brachyurus)}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkfftavstvltskyr

SCOP Domain Coordinates for d1fhjc_:

Click to download the PDB-style file with coordinates for d1fhjc_.
(The format of our PDB-style files is described here.)

Timeline for d1fhjc_: