Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (16 species) |
Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63440] (1 PDB entry) |
Domain d1fhjc_: 1fhj C: [59839] Other proteins in same PDB: d1fhjb_, d1fhjd_ complexed with hem |
PDB Entry: 1fhj (more details), 1.8 Å
SCOP Domain Sequences for d1fhjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhjc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Maned wolf (Chrysocyon brachyurus)} vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa vhasldkfftavstvltskyr
Timeline for d1fhjc_: