![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63440] (1 PDB entry) |
![]() | Domain d1fhjc_: 1fhj C: [59839] Other proteins in same PDB: d1fhjb_, d1fhjd_ complexed with hem |
PDB Entry: 1fhj (more details), 1.8 Å
SCOPe Domain Sequences for d1fhjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhjc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Maned wolf (Chrysocyon brachyurus) [TaxId: 68728]} vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa vhasldkfftavstvltskyr
Timeline for d1fhjc_: