SCOP 1.57: Domain d1fhjb_: 1fhj B:

Lineage for d1fhjb_ (1fhj B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (17 proteins)

6. Protein Hemoglobin, beta-chain [46500] (16 species)

7. Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63441] (1 PDB entry)

8. Domain d1fhjb_: 1fhj B: [59838]
   Other proteins in same PDB: d1fhja_, d1fhjc_

Details for d1fhjb_

PDB Entry: 1fhj, 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.

SCOP Domain Sequences for d1fhjb_:

Sequence; same for both SEQRES and ATOM records:

>d1fhjb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Maned wolf (Chrysocyon brachyurus)}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

Timeline for d1fhjb_:

• d1fhjb_ is new in SCOP 1.57
  
• d1fhjb_ appears in SCOP 1.59
  
• d1fhjb_ appears in the current release, SCOPe 2.08