Lineage for d1fhjb_ (1fhj B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687749Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63441] (1 PDB entry)
  8. 2687750Domain d1fhjb_: 1fhj B: [59838]
    Other proteins in same PDB: d1fhja_, d1fhjc_
    complexed with hem

Details for d1fhjb_

PDB Entry: 1fhj (more details), 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.
PDB Compounds: (B:) hemoglobin (beta chain)

SCOPe Domain Sequences for d1fhjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhjb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Maned wolf (Chrysocyon brachyurus) [TaxId: 68728]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1fhjb_:

Click to download the PDB-style file with coordinates for d1fhjb_.
(The format of our PDB-style files is described here.)

Timeline for d1fhjb_: