Lineage for d1fhja_ (1fhj A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473405Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1473981Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63440] (1 PDB entry)
  8. 1473982Domain d1fhja_: 1fhj A: [59837]
    Other proteins in same PDB: d1fhjb_, d1fhjd_
    complexed with hem

Details for d1fhja_

PDB Entry: 1fhj (more details), 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.
PDB Compounds: (A:) hemoglobin (alpha chain)

SCOPe Domain Sequences for d1fhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhja_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Maned wolf (Chrysocyon brachyurus) [TaxId: 68728]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkfftavstvltskyr

SCOPe Domain Coordinates for d1fhja_:

Click to download the PDB-style file with coordinates for d1fhja_.
(The format of our PDB-style files is described here.)

Timeline for d1fhja_: