SCOP 1.61: Domain d1fhja_: 1fhj A:

Lineage for d1fhja_ (1fhj A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63440] (1 PDB entry)

8. Domain d1fhja_: 1fhj A: [59837]
   Other proteins in same PDB: d1fhjb_, d1fhjd_

Details for d1fhja_

PDB Entry: 1fhj, 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.

SCOP Domain Sequences for d1fhja_:

Sequence; same for both SEQRES and ATOM records:

>d1fhja_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Maned wolf (Chrysocyon brachyurus)}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkfftavstvltskyr

Timeline for d1fhja_:

• d1fhja_ first appeared in SCOP 1.57
  
• d1fhja_ appears in SCOP 1.59
  
• d1fhja_ appears in SCOP 1.63
  
• d1fhja_ appears in the current release, SCOPe 2.08