Lineage for d1fhha_ (1fhh A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464187Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1464196Protein Rubredoxin [57804] (8 species)
  7. 1464197Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
    Uniprot P00268
  8. 1464208Domain d1fhha_: 1fhh A: [59836]
    complexed with fe

Details for d1fhha_

PDB Entry: 1fhh (more details), 1.5 Å

PDB Description: x-ray crystal structure of oxidized rubredoxin
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1fhha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhha_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve

SCOPe Domain Coordinates for d1fhha_:

Click to download the PDB-style file with coordinates for d1fhha_.
(The format of our PDB-style files is described here.)

Timeline for d1fhha_: