SCOP 1.57: Domain d1fh2a_: 1fh2 A:

Lineage for d1fh2a_ (1fh2 A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (38 PDB entries)

8. Domain d1fh2a_: 1fh2 A: [59834]

Details for d1fh2a_

PDB Entry: 1fh2, 1.8 Å

PDB Description: transthyretin stability as a key factor in amyloidogenesis

SCOP Domain Sequences for d1fh2a_:

Sequence; same for both SEQRES and ATOM records:

>d1fh2a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvt

Timeline for d1fh2a_:

• d1fh2a_ is new in SCOP 1.57
  
• d1fh2a_ appears in SCOP 1.59
  
• d1fh2a_ appears in the current release, SCOPe 2.08