Lineage for d1fgra2 (1fgr A:6-149)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57022Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
  4. 57023Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 57024Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 57028Protein Plant lipoxigenase [49725] (2 species)
  7. 57029Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (7 PDB entries)
  8. 57033Domain d1fgra2: 1fgr A:6-149 [59829]
    Other proteins in same PDB: d1fgra1

Details for d1fgra2

PDB Entry: 1fgr (more details), 1.6 Å

PDB Description: lipoxygenase-1 (soybean) at 100k, q697e mutant

SCOP Domain Sequences for d1fgra2:

Sequence, based on SEQRES records: (download)

>d1fgra2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records): (download)

>d1fgra2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
hkikgtvvlmpknelenlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptl
gagesafnihfewdgsmgipgafyiknymqvefflksltleaitirfvcnswvyntklyk
svriffanhty

SCOP Domain Coordinates for d1fgra2:

Click to download the PDB-style file with coordinates for d1fgra2.
(The format of our PDB-style files is described here.)

Timeline for d1fgra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgra1