SCOP 1.75: Domain d1fgqa2: 1fgq A:6-149

Lineage for d1fgqa2 (1fgq A:6-149)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (13 PDB entries)

8. Domain d1fgqa2: 1fgq A:6-149 [59827]
   Other proteins in same PDB: d1fgqa1
   complexed with of1; mutant

Details for d1fgqa2

PDB Entry: 1fgq, 1.85 Å

PDB Description: lipoxygenase-1 (soybean) at 100k, q495e mutant

PDB Compounds: (A:) seed lipoxygenase-1

SCOP Domain Sequences for d1fgqa2:

Sequence, based on SEQRES records:

>d1fgqa2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d1fgqa2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlg
agesafnihfewdgsmgipgafyiknymqvefflksltleaitirfvcnswvyntklyks
vriffanhty

Timeline for d1fgqa2:

• d1fgqa2 first appeared in SCOP 1.57
  
• d1fgqa2 appears in SCOP 1.73
  
• d1fgqa2 appears in SCOPe 2.01
  
• d1fgqa2 appears in the current release, SCOPe 2.08