SCOPe 2.05: Domain d1fgoa2: 1fgo A:6-149

Lineage for d1fgoa2 (1fgo A:6-149)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (16 PDB entries)

8. Domain d1fgoa2: 1fgo A:6-149 [59825]
   Other proteins in same PDB: d1fgoa1
   complexed with fe; mutant

Details for d1fgoa2

PDB Entry: 1fgo, 1.62 Å

PDB Description: lipoxygenase-1 (soybean) at 100k, q495a mutant

PDB Compounds: (A:) seed lipoxygenase-1

SCOPe Domain Sequences for d1fgoa2:

Sequence, based on SEQRES records:

>d1fgoa2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d1fgoa2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag
esafnihfewdgsmgipgafyiknymqvefflksltleatirfvcnswvyntklyksvri
ffanhty

Timeline for d1fgoa2:

• d1fgoa2 first appeared in SCOP 1.57
  
• d1fgoa2 appears in SCOPe 2.04
  
• d1fgoa2 appears in SCOPe 2.06
  
• d1fgoa2 appears in the current release, SCOPe 2.08