Lineage for d1fgoa2 (1fgo A:6-149)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 293644Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 293645Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 293646Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 293650Protein Plant lipoxigenase [49725] (2 species)
  7. 293651Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (8 PDB entries)
  8. 293654Domain d1fgoa2: 1fgo A:6-149 [59825]
    Other proteins in same PDB: d1fgoa1
    complexed with of1; mutant

Details for d1fgoa2

PDB Entry: 1fgo (more details), 1.62 Å

PDB Description: lipoxygenase-1 (soybean) at 100k, q495a mutant

SCOP Domain Sequences for d1fgoa2:

Sequence, based on SEQRES records: (download)

>d1fgoa2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records): (download)

>d1fgoa2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
hkikgtvvlmpknelnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag
esafnihfewdgsmgipgafyiknymqvefflksltleatirfvcnswvyntklyksvri
ffanhty

SCOP Domain Coordinates for d1fgoa2:

Click to download the PDB-style file with coordinates for d1fgoa2.
(The format of our PDB-style files is described here.)

Timeline for d1fgoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgoa1