Lineage for d1fgoa1 (1fgo A:150-839)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50775Fold a.119: Lipoxigenase [48483] (1 superfamily)
  4. 50776Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 50777Family a.119.1.1: Plant lipoxigenases [48485] (1 protein)
  6. 50778Protein Lipoxigenase, C-terminal domain [48486] (2 species)
  7. 50779Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [48487] (7 PDB entries)
  8. 50782Domain d1fgoa1: 1fgo A:150-839 [59824]
    Other proteins in same PDB: d1fgoa2

Details for d1fgoa1

PDB Entry: 1fgo (more details), 1.62 Å

PDB Description: lipoxygenase-1 (soybean) at 100k, q495a mutant

SCOP Domain Sequences for d1fgoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgoa1 a.119.1.1 (A:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1}
vpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhalmshwlnthaamep
fviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssa
vyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyv
plyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasal
haavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlisls
vieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnr
lgpvqlpytllypsseegltfrgipnsisi

SCOP Domain Coordinates for d1fgoa1:

Click to download the PDB-style file with coordinates for d1fgoa1.
(The format of our PDB-style files is described here.)

Timeline for d1fgoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgoa2