Class b: All beta proteins [48724] (119 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (151 PDB entries) |
Domain d1fgcc_: 1fgc C: [59822] |
PDB Entry: 1fgc (more details), 1.9 Å
SCOP Domain Sequences for d1fgcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fgcc_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
Timeline for d1fgcc_: