Lineage for d1fg7a_ (1fg7 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125751Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 125752Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 125753Family c.67.1.1: AAT-like [53384] (6 proteins)
  6. 125920Protein Histidinol-phosphate aminotransferase [64121] (1 species)
  7. 125921Species Escherichia coli [TaxId:562] [64122] (6 PDB entries)
  8. 125922Domain d1fg7a_: 1fg7 A: [59819]

Details for d1fg7a_

PDB Entry: 1fg7 (more details), 1.5 Å

PDB Description: crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate

SCOP Domain Sequences for d1fg7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase {Escherichia coli}
tvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpka
vienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigv
ecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivv
adeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviap
yplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyila
rfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv

SCOP Domain Coordinates for d1fg7a_:

Click to download the PDB-style file with coordinates for d1fg7a_.
(The format of our PDB-style files is described here.)

Timeline for d1fg7a_: