SCOP 1.73: Domain d1fg3a_: 1fg3 A:

Lineage for d1fg3a_ (1fg3 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (8 families)

5. Family c.67.1.1: AAT-like [53384] (16 proteins)

6. Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)

7. Species Escherichia coli [TaxId:562] [64122] (6 PDB entries)

8. Domain d1fg3a_: 1fg3 A: [59813]
   complexed with hsa, plp

Details for d1fg3a_

PDB Entry: 1fg3, 2.2 Å

PDB Description: crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol

PDB Compounds: (A:) histidinol phosphate aminotransferase

SCOP Domain Sequences for d1fg3a_:

Sequence; same for both SEQRES and ATOM records:

>d1fg3a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]}
tvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpka
vienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigv
ecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivv
adeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviap
yplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyila
rfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv

Timeline for d1fg3a_:

• d1fg3a_ first appeared in SCOP 1.57
  
• d1fg3a_ appears in SCOP 1.71
  
• d1fg3a_ appears in SCOP 1.75
  
• d1fg3a_ appears in the current release, SCOPe 2.08