SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ffra3 (1ffr A:444-516)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2165782Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2166209Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2166210Family d.26.3.1: Chitinase insertion domain [54557] (10 protein domains)
  6. 2166253Protein Chitinase A [54558] (1 species)
  7. 2166254Species Serratia marcescens [TaxId:615] [54559] (11 PDB entries)
    Uniprot P07254 24-563
  8. 2166258Domain d1ffra3: 1ffr A:444-516 [59812]
    Other proteins in same PDB: d1ffra1, d1ffra2
    mutant

Details for d1ffra3

PDB Entry: 1ffr (more details), 1.8 Å

PDB Description: crystal structure of chitinase a mutant y390f complexed with hexa-n-acetylchitohexaose (nag)6
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1ffra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffra3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
vfkpstgdlitfd

SCOPe Domain Coordinates for d1ffra3:

Click to download the PDB-style file with coordinates for d1ffra3.
(The format of our PDB-style files is described here.)

Timeline for d1ffra3: