Lineage for d1ffra2 (1ffr A:133-443,A:517-563)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474902Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 474916Protein Chitinase A, catalytic domain [51544] (1 species)
  7. 474917Species Serratia marcescens [TaxId:615] [51545] (8 PDB entries)
  8. 474920Domain d1ffra2: 1ffr A:133-443,A:517-563 [59811]
    Other proteins in same PDB: d1ffra1, d1ffra3

Details for d1ffra2

PDB Entry: 1ffr (more details), 1.8 Å

PDB Description: crystal structure of chitinase a mutant y390f complexed with hexa-n- acetylchitohexaose (nag)6

SCOP Domain Sequences for d1ffra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffra2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens}
tdgshlaplkeplleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfi
picggngindslkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgn
fgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdi
dwefpggkganpnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidk
vaynvaqnsmdhiflmsfdfygafdlknlghqtalnapawkpdtayttvngvnallaqgv
kpgkivvgtamXdarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq

SCOP Domain Coordinates for d1ffra2:

Click to download the PDB-style file with coordinates for d1ffra2.
(The format of our PDB-style files is described here.)

Timeline for d1ffra2: