SCOPe 2.06: Domain d1ffra1: 1ffr A:24-132

Lineage for d1ffra1 (1ffr A:24-132)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Chitinase A, N-terminal domain N [49233] (1 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries)
   Uniprot P07254 24-563

8. Domain d1ffra1: 1ffr A:24-132 [59810]
   Other proteins in same PDB: d1ffra2, d1ffra3
   mutant

Details for d1ffra1

PDB Entry: 1ffr, 1.8 Å

PDB Description: crystal structure of chitinase a mutant y390f complexed with hexa-n- acetylchitohexaose (nag)6

PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1ffra1:

Sequence; same for both SEQRES and ATOM records:

>d1ffra1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

Timeline for d1ffra1:

• d1ffra1 first appeared in SCOP 1.57
  
• d1ffra1 appears in SCOPe 2.05
  
• d1ffra1 appears in SCOPe 2.07
  
• d1ffra1 appears in the current release, SCOPe 2.08