Lineage for d1ffra1 (1ffr A:24-132)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291541Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 291557Protein Chitinase A, N-terminal domain N [49233] (1 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 291558Species Serratia marcescens [TaxId:615] [49234] (8 PDB entries)
  8. 291561Domain d1ffra1: 1ffr A:24-132 [59810]
    Other proteins in same PDB: d1ffra2, d1ffra3
    complexed with nag; mutant

Details for d1ffra1

PDB Entry: 1ffr (more details), 1.8 Å

PDB Description: crystal structure of chitinase a mutant y390f complexed with hexa-n- acetylchitohexaose (nag)6

SCOP Domain Sequences for d1ffra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffra1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOP Domain Coordinates for d1ffra1:

Click to download the PDB-style file with coordinates for d1ffra1.
(The format of our PDB-style files is described here.)

Timeline for d1ffra1: