Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (17 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location |
Protein Chitinase A, N-terminal domain N [49233] (1 species) precedes the catalytic (beta/alpha)8-barrel domain |
Species Serratia marcescens [TaxId:615] [49234] (7 PDB entries) |
Domain d1ffra1: 1ffr A:24-132 [59810] Other proteins in same PDB: d1ffra2, d1ffra3 complexed with nag; mutant |
PDB Entry: 1ffr (more details), 1.8 Å
SCOP Domain Sequences for d1ffra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffra1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens} aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad
Timeline for d1ffra1: