Lineage for d1fffd_ (1fff D:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803906Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 803907Superfamily b.50.1: Acid proteases [50630] (3 families) (S)
  5. 803908Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 803924Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 803925Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (247 PDB entries)
    Uniprot P35963 57-155
    Uniprot P04587 69-167
    Uniprot P03366 69-167
    Uniprot P03367 69-167
    Uniprot P03368 69-167
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 804120Domain d1fffd_: 1fff D: [59807]
    complexed with dcl, nh2; mutant

Details for d1fffd_

PDB Entry: 1fff (more details), 1.9 Å

PDB Description: structural implications of drug resistant mutants of hiv-1 protease : high resolution crystal structures of the mutant protease/substrate analog complexes.
PDB Compounds: (D:) protease retropepsin

SCOP Domain Sequences for d1fffd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fffd_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOP Domain Coordinates for d1fffd_:

Click to download the PDB-style file with coordinates for d1fffd_.
(The format of our PDB-style files is described here.)

Timeline for d1fffd_: