SCOP 1.73: Domain d1feua_: 1feu A:

Lineage for d1feua_ (1feu A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
   barrel, closed; n=6, S=10; complex topology

4. Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families)

5. Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)

6. Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (1 species)
   contains additional all-beta (sub)domain in the C-terminal extension

7. Species Thermus thermophilus [TaxId:274] [63799] (1 PDB entry)

8. Domain d1feua_: 1feu A: [59801]

Details for d1feua_

PDB Entry: 1feu, 2.3 Å

PDB Description: crystal structure of ribosomal protein tl5, one of the ctc family proteins, complexed with a fragment of 5s rrna.

PDB Compounds: (A:) 50S ribosomal protein L25

SCOP Domain Sequences for d1feua_:

Sequence; same for both SEQRES and ATOM records:

>d1feua_ b.53.1.1 (A:) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
meyrlkayyregekpsalrragklpglmynrhlnrkvyvdlvefdkvfrqasihhvivle
lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
eklae

Timeline for d1feua_:

• d1feua_ first appeared in SCOP 1.57
  
• d1feua_ appears in SCOP 1.71
  
• d1feua_ appears in SCOP 1.75
  
• d1feua_ appears in the current release, SCOPe 2.08