SCOPe 2.03: Domain d1fesa_: 1fes A:

Lineage for d1fesa_ (1fes A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)

8. Domain d1fesa_: 1fes A: [59800]
   apo form

Details for d1fesa_

PDB Entry: 1fes

PDB Description: solution structure of the apo form of the yeast metallochaperone, atx1

PDB Compounds: (A:) atx1 copper chaperone

SCOPe Domain Sequences for d1fesa_:

Sequence; same for both SEQRES and ATOM records:

>d1fesa_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
kktgkevrsgkql

Timeline for d1fesa_:

• d1fesa_ first appeared in SCOP 1.57
  
• d1fesa_ appears in SCOPe 2.02
  
• d1fesa_ appears in SCOPe 2.04
  
• d1fesa_ appears in the current release, SCOPe 2.08