![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (40 superfamilies) |
![]() | Superfamily d.58.17: Metal-binding domain [55008] (1 family) ![]() |
![]() | Family d.58.17.1: Metal-binding domain [55009] (7 proteins) |
![]() | Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (4 PDB entries) |
![]() | Domain d1fesa_: 1fes A: [59800] |
PDB Entry: 1fes (more details)
SCOP Domain Sequences for d1fesa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fesa_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae)} maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki kktgkevrsgkql
Timeline for d1fesa_: