SCOP 1.67: Domain d1fe8n1: 1fe8 N:1-107

Lineage for d1fe8n1 (1fe8 N:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1fe8n1: 1fe8 N:1-107 [59796]
   Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l2, d1fe8m2, d1fe8n2
   part of Fab RU5 inhibiting the collagen binding by the von willebrand factor a3 domain
   complexed with cac, fuc, nag

Details for d1fe8n1

PDB Entry: 1fe8, 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8n1:

Sequence; same for both SEQRES and ATOM records:

>d1fe8n1 b.1.1.1 (N:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diamtqttsslsaslgqkvtiscrasqdignylnwyqqkpdgtvrlliyytsrlhsgvps
rfsgsgsgtdysltisnlesediatyfcqnggtnpwtfgggtklevk

Timeline for d1fe8n1:

• d1fe8n1 first appeared in SCOP 1.57
  
• d1fe8n1 appears in SCOP 1.65
  
• d1fe8n1 appears in SCOP 1.69
  
• d1fe8n1 appears in the current release, SCOPe 2.08