Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab RU5, (mouse), kappa L chain [63653] (1 PDB entry) |
Domain d1fe8l2: 1fe8 L:108-211 [59793] Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8i1, d1fe8j1, d1fe8l1, d1fe8m1, d1fe8n1 |
PDB Entry: 1fe8 (more details), 2.03 Å
SCOP Domain Sequences for d1fe8l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe8l2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab RU5, (mouse), kappa L chain} radaapttsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1fe8l2: