SCOP 1.63: Domain d1fe8j2: 1fe8 J:116-216

Lineage for d1fe8j2 (1fe8 J:116-216)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab RU5, (mouse), kappa L chain [63653] (1 PDB entry)
   inhibits collagen binding by the von willebrand factor a3 domain

8. Domain d1fe8j2: 1fe8 J:116-216 [59791]
   Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8i1, d1fe8j1, d1fe8l1, d1fe8m1, d1fe8n1
   complexed with cac, fuc, nag

Details for d1fe8j2

PDB Entry: 1fe8, 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8j2:

Sequence; same for both SEQRES and ATOM records:

>d1fe8j2 b.1.1.2 (J:116-216) Immunoglobulin (constant domains of L and H chains) {Fab RU5, (mouse), kappa L chain}
aettapsvyklepvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkieprg

Timeline for d1fe8j2:

• d1fe8j2 first appeared in SCOP 1.57
  
• d1fe8j2 appears in SCOP 1.61
  
• d1fe8j2 appears in SCOP 1.65
  
• d1fe8j2 appears in the current release, SCOPe 2.08