| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab RU5, (mouse), kappa L chain [63640] (1 PDB entry) inhibits collagen binding by the von willebrand factor a3 domain |
| Domain d1fe8j1: 1fe8 J:1-115 [59790] Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h2, d1fe8i2, d1fe8j2, d1fe8l2, d1fe8m2, d1fe8n2 complexed with cac, fuc, nag |
PDB Entry: 1fe8 (more details), 2.03 Å
SCOP Domain Sequences for d1fe8j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe8j1 b.1.1.1 (J:1-115) Immunoglobulin (variable domains of L and H chains) {Fab RU5, (mouse), kappa L chain}
dvklvqsgpglvapsqslsitctvsgfslttygvswvrqppgkglewlgviwgdgnttyh
salisrlsiskdnsrsqvflklnslhtddtatyycagnyygmdywgqgtsvtvss
Timeline for d1fe8j1: