Lineage for d1fe8h1 (1fe8 H:1-115)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219936Species Fab RU5, (mouse), kappa L chain [63640] (1 PDB entry)
    inhibits collagen binding by the von willebrand factor a3 domain
  8. 219937Domain d1fe8h1: 1fe8 H:1-115 [59786]
    Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h2, d1fe8i2, d1fe8j2, d1fe8l2, d1fe8m2, d1fe8n2

Details for d1fe8h1

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8h1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab RU5, (mouse), kappa L chain}
dvklvqsgpglvapsqslsitctvsgfslttygvswvrqppgkglewlgviwgdgnttyh
salisrlsiskdnsrsqvflklnslhtddtatyycagnyygmdywgqgtsvtvss

SCOP Domain Coordinates for d1fe8h1:

Click to download the PDB-style file with coordinates for d1fe8h1.
(The format of our PDB-style files is described here.)

Timeline for d1fe8h1: